Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial (Active)

CAT:
399-GTR17011060
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial (Active)

  • Product Name Alternative:

    Epithelial cell adhesion molecule; Ep-CAM; Adenocarcinoma-associated antigen; Cell surface glycoprotein Trop-1; Epithelial cell surface antigen; Epithelial glycoprotein; EGP; Epithelial glycoprotein 314; EGP314; hEGP314; KS 1/4 antigen; KSA; Major gastrointestinal tumor-associated protein GA733-2; Tumor-associated calcium signal transducer 1; CD antigen CD326

  • Abbreviation:

    Recombinant Human EPCAM protein, partial (Active)

  • Gene Name:

    EPCAM

  • UniProt:

    P16422

  • Expression Region:

    24-265aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

  • Tag:

    C-terminal 10xHis-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Cancer

  • Relevance:

    May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    1Measured by its binding ability in a functional ELISA. Immobilized Human EPCAM at 2 μg/mL can bind Anti-EPCAM recombinant antibody (CSB-RA007717MA2HU) . The EC50 is 1.098-1.401 ng/mL. 2EPCAM Recombinant Monoclonal Antibody (CSB-RA007717MA2HU) captured on Protein A Chip can bind Human EPCAM with an affinity constant of 0.742 nM as detected by MetaSPR Assay (WeSPRTM 200) .

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    28.8 kDa

  • References & Citations:

    The tumour-associated antigen EpCAM upregulates the fatty acid binding protein E-FABP. Muenz M., Zeidler R., Gires O. Cancer Lett. 225:151-157 (2005)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Transmembrane Domains:

    0TM

  • Protein Length:

    Partial