Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial

• Product Name Alternative:

  Adenocarcinoma-associated antigen Cell surface glycoprotein Trop-1 Epithelial cell surface antigen Epithelial glycoprotein Short name: EGP Epithelial glycoprotein 314 Short name: EGP314 Short name: hEGP314 KS 1/4 antigen KSA Major gastrointestinal tumor-associated protein GA733-2 Tumor-associated calcium signal transducer 1 CD_antigen: CD326

• Abbreviation:

  Recombinant Human EPCAM protein, partial

• Gene Name:

  EPCAM

• UniProt:

  P16422

• Expression Region:

  24-265aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

• Tag:

  N-terminal 6xHis-SUMO-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Tags & Cell Markers

• Relevance:

  May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.

• Molecular Weight:

  40.4 kDa

• References & Citations:

  "Molecular cloning and characterization of a human adenocarcinoma/epithelial cell surface antigen complementary DNA."Strnad J., Hamilton A.E., Beavers L.S., Gamboa G.C., Apelgren L.D., Taber L.D., Sportsman J.R., Bumol T.F., Sharp J.D., Gadski R.A.Cancer Res. 49:314-317 (1989)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial