Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial (Active)

• Product Name Alternative:

  Epithelial cell adhesion molecule; Ep-CAM; Adenocarcinoma-associated antigen; Cell surface glycoprotein Trop-1; Epithelial cell surface antigen; Epithelial glycoprotein; EGP; Epithelial glycoprotein 314; EGP314; hEGP314; KS 1/4 antigen; KSA; Major gastrointestinal tumor-associated protein GA733-2; Tumor-associated calcium signal transducer 1; CD antigen CD326

• Abbreviation:

  Recombinant Human EPCAM protein, partial (Active)

• Gene Name:

  EPCAM

• UniProt:

  P16422

• Expression Region:

  24-265aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

• Tag:

  C-terminal 10xHis-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Relevance:

  May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  1Measured by its binding ability in a functional ELISA. Immobilized Human EPCAM at 2 μg/mL can bind Anti-EPCAM recombinant antibody (CSB-RA007717MA2HU) . The EC50 is 1.098-1.401 ng/mL. 2EPCAM Recombinant Monoclonal Antibody (CSB-RA007717MA2HU) captured on Protein A Chip can bind Human EPCAM with an affinity constant of 0.742 nM as detected by MetaSPR Assay (WeSPRTM 200) .

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  28.8 kDa

• References & Citations:

  The tumour-associated antigen EpCAM upregulates the fatty acid binding protein E-FABP. Muenz M., Zeidler R., Gires O. Cancer Lett. 225:151-157 (2005)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Transmembrane Domains:

  0TM

• Protein Length:

  Partial