Recombinant Human Endothelin-1 receptor (EDNRA) -VLPs (Active)

• Product Name Alternative:

  Endothelin-1 receptor; Endothelin receptor type A; EDNRA; ETA, ETRA

• Abbreviation:

  Recombinant Human EDNRA protein-VLPs (Active)

• Gene Name:

  EDNRA

• UniProt:

  P25101

• Expression Region:

  21-427aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN

• Tag:

  C-terminal 10xHis-tagged

• Type:

  MP-VLP Transmembrane Protein & Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Signal Transduction

• Relevance:

  Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  The purity information is not available for VLPs proteins.

• Activity:

  Yes

• Bioactivity:

  Measured by its binding ability in a functional ELISA. Immobilized Human EDNRA at 10 μg/mL can bind Anti-EDNRA recombinant antibody (CSB-RA007403MA3HU) . The EC50 is 2.225-3.570 ng/mL. The VLPs (CSB-MP3838) is negative control.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered PBS, 0.2 M Arginine, 6% Trehalose

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

• Molecular Weight:

  47.9 kDa

• References & Citations:

  Mutations in the endothelin receptor type A cause mandibulofacial dysostosis with alopecia. Gordon C.T., Weaver K.N., Zechi-Ceide R.M., Madsen E.C., Tavares A.L., Oufadem M., Kurihara Y., Adameyko I., Picard A., Amiel J. Am. J. Hum. Genet. 96:519-531 (2015)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein