Recombinant Human Endothelin-1 receptor (EDNRA) -VLPs (Active)

CAT:
399-GTR13447716
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Endothelin-1 receptor (EDNRA) -VLPs (Active)

  • Product Name Alternative:

    Endothelin-1 receptor; Endothelin receptor type A; EDNRA; ETA, ETRA

  • Abbreviation:

    Recombinant Human EDNRA protein-VLPs (Active)

  • Gene Name:

    EDNRA

  • UniProt:

    P25101

  • Expression Region:

    21-427aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN

  • Tag:

    C-terminal 10xHis-tagged

  • Type:

    MP-VLP Transmembrane Protein & Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Signal Transduction

  • Relevance:

    Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    The purity information is not available for VLPs proteins.

  • Activity:

    Yes

  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Human EDNRA at 10 μg/mL can bind Anti-EDNRA recombinant antibody (CSB-RA007403MA3HU) . The EC50 is 2.225-3.570 ng/mL. The VLPs (CSB-MP3838) is negative control.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered PBS, 0.2 M Arginine, 6% Trehalose

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

  • Molecular Weight:

    47.9 kDa

  • References & Citations:

    Mutations in the endothelin receptor type A cause mandibulofacial dysostosis with alopecia. Gordon C.T., Weaver K.N., Zechi-Ceide R.M., Madsen E.C., Tavares A.L., Oufadem M., Kurihara Y., Adameyko I., Picard A., Amiel J. Am. J. Hum. Genet. 96:519-531 (2015)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein