Recombinant Human Endothelin-1 receptor (EDNRA), partial

• Product Name Alternative:

  Endothelin A receptor ; ET-A ; ETA-R ; hET-AR

• Abbreviation:

  Recombinant Human EDNRA protein, partial

• Gene Name:

  EDNRA

• UniProt:

  P25101

• Expression Region:

  21-80aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK

• Tag:

  N-terminal 6xHis-tagged

• Type:

  In Stock Protein

• Source:

  Yeast

• Field of Research:

  Signal Transduction

• Relevance:

  Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger syst. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is

• Molecular Weight:

  8.8 kDa

• References & Citations:

  Cloning and characterization of cDNA encoding human A-type endothelin receptor.Adachi M., Yang Y.Y., Furuichi Y., Miyamoto C.Biochem. Biophys. Res. Commun. 180:1265-1272 (1991)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial