Recombinant Mouse Claudin-6 (Cldn6) -VLPs (Active)

• Product Name Alternative:

  Claudin-6; Skullin; Cldn6

• Abbreviation:

  Recombinant Mouse Cldn6 protein-VLPs (Active)

• Gene Name:

  Cldn6

• UniProt:

  Q9Z262

• Expression Region:

  1-219aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVTLLIVLLGLLVYLAGAKCTTCVEDRNSKSRLVLISGIIFVISGVLTLIPVCWTAHSIIQDFYNPLVADAQKRELGASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGPSEYPTKNYV

• Tag:

  C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

• Type:

  MP-VLP Transmembrane Protein & Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Relevance:

  Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SEC-HPLC.

• Activity:

  Yes

• Bioactivity:

  ①Measured by its binding ability in a functional ELISA. Immobilized Mouse cldn6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU) . The EC50 is 4.027-6.270 ng/mL.The VLPs (CSB-MP3838) is negative control. ②Measured by its binding ability in a functional ELISA. Immobilized Mouse cldn6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA3HU) . The EC50 is 7.349-12.12 ng/mL.The VLPs (CSB-MP3838) is negative control.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

• Molecular Weight:

  24.8 kDa

• References & Citations:

  The transcriptional landscape of the mammalian genome. Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Hayashizaki Y. Science 309:1559-1563 (2005)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length