Recombinant Human Claudin-6 (CLDN6) -Detergent (Active)

• CAS Number:

  9000-83-3

• Gene Name:

  CLDN6

• UniProt:

  P56747

• Expression Region:

  2-220aa

• Organism:

  Homo sapiens

• Target Sequence:

  ASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

• Tag:

  Email us to check on the available tags

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Assay Type:

  MP-Detergent Transmembrane Protein & Active Protein & In Stock Protein

• Relevance:

  Plays a major role in tight junction-specific obliteration of the intercellular space. (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells.

• Endotoxin:

  Less than 1.0 EU/ug as determined by LAL method.

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL on an Nickel Coated plate can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU). The EC50 is 0.6949-1.158 ng/mL.

• Length:

  Partial

• Form:

  Liquid

• Buffer:

  50 mM HEPES，0.15 M NaCl， 0.05% DDM，0.01% CHS，pH7.5

• Molecular Weight:

  27.7 kDa

• References & Citations:

  "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Gray A.M. Genome Res. 13:2265-2270 (2003) "Complete sequencing and characterization of 21, 243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S. Nat. Genet. 36:40-45 (2004)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.