Recombinant Human Claudin-6 (CLDN6) -VLPs (Active)

• CAS Number:

  9000-83-3

• Gene Name:

  CLDN6

• UniProt:

  P56747

• Expression Region:

  1-220aa

• Organism:

  Homo sapiens

• Target Sequence:

  MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

• Tag:

  C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Assay Type:

  MP-VLP Transmembrane Protein & Active Protein & In Stock Protein

• Relevance:

  "Claudin association with CD81 defines hepatitis C virus entry." Harris H.J., Davis C., Mullins J.G., Hu K., Goodall M., Farquhar M.J., Mee C.J., McCaffrey K., Young S., Drummer H., Balfe P., McKeating J.A. J. Biol. Chem. 285:21092-21102 (2010)

• Endotoxin:

  Less than 1.0 EU/ug as determined by LAL method.

• Purity:

  The purity information is not available for VLPs proteins.

• Activity:

  Yes

• Bioactivity:

  Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 μg/mL can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU), the EC50 is 1.501-2.035 ng/mL

• Length:

  Full Length

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle miXIng. Avoid vigorous shaking or vorteXIng.

• Molecular Weight:

  25.1 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.