Recombinant Human ADP-ribose glycohydrolase MACROD1 (MACROD1)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Recombinant Human ADP-ribose glycohydrolase MACROD1 (MACROD1)
Product Name Alternative:
MACRO domain-containing protein 1 O-acetyl-ADP-ribose deacetylase MACROD1 Protein LRP16 [Protein ADP-ribosylaspartate] hydrolase MACROD1 [Protein ADP-ribosylglutamate] hydrolase MACROD1
Abbreviation:
Recombinant Human MACROD1 protein
Gene Name:
MACROD1
UniProt:
Q9BQ69
Expression Region:
1-325aa
Organism:
Homo sapiens (Human)
Target Sequence:
MSLQSRLSGRLAQLRAAGQLLVPPRPRPGHLAGATRTRSSTCGPPAFLGVFGRRARTSAGVGAWGAAAVGRTAGVRTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVAVKVEEPRYKKDKQLNEKISLLRSDITKLEVDAIVNAANSSLLGGGGVDGCIHRAAGPLLTDECRTLQSCKTGKAKITGGYRLPAKYVIHTVGPIAYGEPSASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPCEAAAEIVLATLREWLEQHKDKVDRLIICVFLEKDEDIYRSRLPHYFPVA
Tag:
N-terminal 6xHis-tagged
Type:
In Stock Protein
Source:
E.coli
Field of Research:
Cancer
Relevance:
Removes ADP-ribose from asparatate and glutamate residues in proteins bearing a single ADP-ribose moiety (PubMed:23474714, PubMed:23474712) . Inactive towards proteins bearing poly-ADP-ribose (PubMed:23474714, PubMed:23474712) . Deacetylates O-acetyl-ADP ribose, a signaling molecule generated by the deacetylation of acetylated lysine residues in histones and other proteins (PubMed:21257746) . Plays a role in estrogen signaling (PubMed:17893710, PubMed:17914104, PubMed:19403568) . Binds to androgen receptor (AR) and amplifies the transactivation function of AR in response to androgen (PubMed:19022849) . May play an important role in carcinogenesis and/or progression of hormone-dependent cancers by feed-forward mechanism that activates ESR1 transactivation (PubMed:17893710, PubMed:17914104) . Could be an ESR1 coactivator, providing a positive feedback regulatory loop for ESR1 signal transduction (PubMed:17914104) . Could be involved in invasive growth by down-regulating CDH1 in endometrial cancer cells (PubMed:17893710) . Enhances ESR1-mediated transcription activity (PubMed:17914104) .
Endotoxin:
Not test
Purity:
Greater than 85% as determined by SDS-PAGE.
Activity:
Not Test
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight:
41.5 kDa
References & Citations:
"Macrodomain-containing proteins are new mono-ADP-ribosylhydrolases." Rosenthal F., Feijs K.L., Frugier E., Bonalli M., Forst A.H., Imhof R., Winkler H.C., Fischer D., Caflisch A., Hassa P.O., Luescher B., Hottiger M.O. Nat. Struct. Mol. Biol. 20:502-507 (2013)
Storage Conditions:
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length:
Full Length