Recombinant Human ADP-ribose glycohydrolase MACROD1 (MACROD1)

CAT:
399-GTR04825922
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human ADP-ribose glycohydrolase MACROD1 (MACROD1)

  • Product Name Alternative:

    MACRO domain-containing protein 1 O-acetyl-ADP-ribose deacetylase MACROD1 Protein LRP16 [Protein ADP-ribosylaspartate] hydrolase MACROD1 [Protein ADP-ribosylglutamate] hydrolase MACROD1

  • Abbreviation:

    Recombinant Human MACROD1 protein

  • Gene Name:

    MACROD1

  • UniProt:

    Q9BQ69

  • Expression Region:

    1-325aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    MSLQSRLSGRLAQLRAAGQLLVPPRPRPGHLAGATRTRSSTCGPPAFLGVFGRRARTSAGVGAWGAAAVGRTAGVRTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVAVKVEEPRYKKDKQLNEKISLLRSDITKLEVDAIVNAANSSLLGGGGVDGCIHRAAGPLLTDECRTLQSCKTGKAKITGGYRLPAKYVIHTVGPIAYGEPSASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPCEAAAEIVLATLREWLEQHKDKVDRLIICVFLEKDEDIYRSRLPHYFPVA

  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged

  • Type:

    In Stock Protein

  • Source:

    Baculovirus

  • Field of Research:

    Cancer

  • Relevance:

    Removes ADP-ribose from asparatate and glutamate residues in proteins bearing a single ADP-ribose moiety (PubMed:23474714, PubMed:23474712) . Inactive towards proteins bearing poly-ADP-ribose (PubMed:23474714, PubMed:23474712) . Deacetylates O-acetyl-ADP ribose, a signaling molecule generated by the deacetylation of acetylated lysine residues in histones and other proteins (PubMed:21257746) . Plays a role in estrogen signaling (PubMed:17893710, PubMed:17914104, PubMed:19403568) . Binds to androgen receptor (AR) and amplifies the transactivation function of AR in response to androgen (PubMed:19022849) . May play an important role in carcinogenesis and/or progression of hormone-dependent cancers by feed-forward mechanism that activates ESR1 transactivation (PubMed:17893710, PubMed:17914104) . Could be an ESR1 coactivator, providing a positive feedback regulatory loop for ESR1 signal transduction (PubMed:17914104) . Could be involved in invasive growth by down-regulating CDH1 in endometrial cancer cells (PubMed:17893710) . Enhances ESR1-mediated transcription activity (PubMed:17914104) .

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    39.5 kDa

  • References & Citations:

    "Macrodomain-containing proteins are new mono-ADP-ribosylhydrolases." Rosenthal F., Feijs K.L., Frugier E., Bonalli M., Forst A.H., Imhof R., Winkler H.C., Fischer D., Caflisch A., Hassa P.O., Luescher B., Hottiger M.O. Nat. Struct. Mol. Biol. 20:502-507 (2013)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length