Recombinant Sheep Dipeptidase 1 (DPEP1)

• Product Name Alternative:

  (Beta-lactamase) (Microsomal dipeptidase)

• Abbreviation:

  Recombinant Sheep DPEP1 protein

• Gene Name:

  DPEP1

• UniProt:

  P43477

• Expression Region:

  17-384aa

• Organism:

  Ovis aries (Sheep)

• Target Sequence:

  DQFRDNAVRLMQSTPVIDGHNDLPWALLKKFNNQLQDPRANLTSLNSTHTNIPKLKAGFVGAQFWSAYTPCDTQNKDSVKRTVEQIDVIQRMCQLYPETFLCVTDSAGIQQAFQEGKVASLVGVEGGHSIDSSLGVLRALYHLGMRYLTLTHSCNTPWADNWLVDTGEDKAQSQGLSSFGQSVVKEMNRLGIIIDLAHVSVATMEAALQLSKAPVIFSHSSAYSLCHHRRNVPDHVLQLVKQTGSLVMVNFYNDYVSCKAEANLSQVADHLDYIKKVAGAGAVGFGGDYDGVSRLPSGLEDVSKYPDLVAELLRRQWTEEEVRGALAENLLRVFKAVEQASDHKQAPGEEPIPLGQLEASCRTKYGYS

• Tag:

  N-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Cancer

• Relevance:

  Hydrolyzes a wide range of dipeptides. Hydrolyzes the conversion of leukotriene D4 to leukotriene E4. Hydrolyzes cystinyl-bis-glycine (cys-bis-gly) formed during glutathione degradation. Possesses also beta lactamase activity and hydrolytically inactivates beta-lactam antibiotics.; Independently of its dipeptidase activity, acts as an adhesion receptor for neutrophil recruitment from bloodstream into inflamed lungs and liver.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  43.3 kDa

• References & Citations:

  "Molecular cloning of sheep lung dipeptidase: a glycosyl phosphatidylinositol-anchored ectoenzyme that converts leukotriene D4 to leukotriene E4." An S., Schmidt F.J., Campbell B.J. Biochim. Biophys. Acta 1226:337-340 (1994)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein