Recombinant Sheep Dipeptidase 1 (DPEP1)

CAT:
399-GTR04828685
Size:
200 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Sheep Dipeptidase 1 (DPEP1)

  • Product Name Alternative:

    (Beta-lactamase) (Microsomal dipeptidase)

  • Abbreviation:

    Recombinant Sheep DPEP1 protein

  • Gene Name:

    DPEP1

  • UniProt:

    P43477

  • Expression Region:

    17-384aa

  • Organism:

    Ovis aries (Sheep)

  • Target Sequence:

    DQFRDNAVRLMQSTPVIDGHNDLPWALLKKFNNQLQDPRANLTSLNSTHTNIPKLKAGFVGAQFWSAYTPCDTQNKDSVKRTVEQIDVIQRMCQLYPETFLCVTDSAGIQQAFQEGKVASLVGVEGGHSIDSSLGVLRALYHLGMRYLTLTHSCNTPWADNWLVDTGEDKAQSQGLSSFGQSVVKEMNRLGIIIDLAHVSVATMEAALQLSKAPVIFSHSSAYSLCHHRRNVPDHVLQLVKQTGSLVMVNFYNDYVSCKAEANLSQVADHLDYIKKVAGAGAVGFGGDYDGVSRLPSGLEDVSKYPDLVAELLRRQWTEEEVRGALAENLLRVFKAVEQASDHKQAPGEEPIPLGQLEASCRTKYGYS

  • Tag:

    N-terminal 6xHis-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Cancer

  • Relevance:

    Hydrolyzes a wide range of dipeptides. Hydrolyzes the conversion of leukotriene D4 to leukotriene E4. Hydrolyzes cystinyl-bis-glycine (cys-bis-gly) formed during glutathione degradation. Possesses also beta lactamase activity and hydrolytically inactivates beta-lactam antibiotics.; Independently of its dipeptidase activity, acts as an adhesion receptor for neutrophil recruitment from bloodstream into inflamed lungs and liver.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    43.3 kDa

  • References & Citations:

    "Molecular cloning of sheep lung dipeptidase: a glycosyl phosphatidylinositol-anchored ectoenzyme that converts leukotriene D4 to leukotriene E4." An S., Schmidt F.J., Campbell B.J. Biochim. Biophys. Acta 1226:337-340 (1994)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein