Recombinant Mouse Dipeptidase 3 (Dpep3)

• Product Name Alternative:

  Membrane-bound dipeptidase 3; MBD-3; Protein expressed in male leptotene and zygotene spermatocytes 136; MLZ-136

• Abbreviation:

  Recombinant Mouse Dpep3 protein

• Gene Name:

  Dpep3

• UniProt:

  Q9DA79

• Expression Region:

  36-462aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  TCTLTTPSPSSAPTTPEASNATTAPGIPNDTATSGVTSDPRLREQALALMRDFPLVDGHNDLPLLLRELFQNQLQDVNLRNFTRGQTNLDRLRDGLVGAQFWSAYIPCQTQDRDAVRLALEQIDLIRRMCSAYPELELVTSADGLNNTQKLACLIGVEGGHSLDTSLAVLRSFYELGVRYLTLTFTCSTPWAESATKFRHHFYTNISGLTSFGEKVVEEMNRLGMMIDLSHASDTLVKQTLEVSQAPVIFSHSAARSVCDNLLNIPDDILQLLKKNGGIVMVTLSMGVLQCSLFANVSTVADHFDHIRTVIGSEFIGIGGSYDGSGRFPQGLEDVSTYPVLIEELLSRGWDERELQGVLRGNLLRVFRQVEQVREKSLGQSPVEVKFPERQQSNTCHSHLLPQPQEDQHQDTHLKVTKLPNILQRAS

• Tag:

  C-terminal 10xHis-tagged

• Type:

  In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Cell Biology

• Relevance:

  Lacks dipeptidase activity and is unable to hydrolyze cystinyl-bis-glycine. The absence of activity may be due to the inability of serine (instead of aspartate found in DPEP1/2) at position 356 to function as the acid/base catalyst and activate the nucleophilic water/hydroxide. Does not hydrolyze leukotriene D4 (LTD4) into leukotriene E4 (LTE4) . Does not hydrolyze the beta-lactam antibiotic imipenem.

• Endotoxin:

  Not test

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  48.7 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein