Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial, Biotinylated (Active)

• Product Name Alternative:

  IL4RA;582J2.1

• Abbreviation:

  Recombinant Human IL4R protein, partial, Biotinylated (Active)

• Gene Name:

  IL4R

• UniProt:

  P24394

• Expression Region:

  26-232aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH

• Tag:

  C-terminal 10xHis-Avi-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Relevance:

  May couple to the JAK1/2/3-STAT6 pathway and promote Th2 differentiation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Measured by its binding ability in a functional ELISA. Immobilized Human IL4 (CSB-MP011659HU) at 2 μg/mL can bind biotinylated Human IL4R. The EC50 is 12.68-14.23 ng/mL.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  28.3 kDa

• References & Citations:

  "Human interleukin 4 receptor confers biological responsiveness and defines a novel receptor superfamily." Idzerda R.L., March C.J., Mosley B., Lyman S.D., Bos T.V., Gimpel S.D., Din W.S., Grabstein K.H., Widmer M.B., Beckmann M.P. J. Exp. Med. 171:861-873 (1990) "Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q." Loftus B.J., Kim U.-J., Sneddon V.P., Kalush F., Brandon R., Fuhrmann J., Mason T., Crosby M.L., Barnstead M., Adams M.D. Genomics 60:295-308 (1999)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial