Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial, Biotinylated (Active)

CAT:
399-GTR04828545
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial, Biotinylated (Active)

  • Product Name Alternative:

    IL4RA;582J2.1

  • Abbreviation:

    Recombinant Human IL4R protein, partial, Biotinylated (Active)

  • Gene Name:

    IL4R

  • UniProt:

    P24394

  • Expression Region:

    26-232aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH

  • Tag:

    C-terminal 10xHis-Avi-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Cancer

  • Relevance:

    May couple to the JAK1/2/3-STAT6 pathway and promote Th2 differentiation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Human IL4 (CSB-MP011659HU) at 2 μg/mL can bind biotinylated Human IL4R. The EC50 is 12.68-14.23 ng/mL.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    28.3 kDa

  • References & Citations:

    "Human interleukin 4 receptor confers biological responsiveness and defines a novel receptor superfamily." Idzerda R.L., March C.J., Mosley B., Lyman S.D., Bos T.V., Gimpel S.D., Din W.S., Grabstein K.H., Widmer M.B., Beckmann M.P. J. Exp. Med. 171:861-873 (1990) "Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q." Loftus B.J., Kim U.-J., Sneddon V.P., Kalush F., Brandon R., Fuhrmann J., Mason T., Crosby M.L., Barnstead M., Adams M.D. Genomics 60:295-308 (1999)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial