Recombinant Human Claudin-6 (CLDN6) -VLPs, Fluorescent (Active)

CAT:
399-GTR04837309
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Claudin-6 (CLDN6) -VLPs, Fluorescent (Active)

  • CAS Number:

    9000-83-3

  • Gene Name:

    CLDN6

  • UniProt:

    P56747

  • Expression Region:

    1-220aa

  • Organism:

    Homo sapiens

  • Target Sequence:

    MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

  • Tag:

    C-terminal EGFP-tagged

  • Source:

    Mammalian cell

  • Field of Research:

    Cancer

  • Assay Type:

    MP-VLP Transmembrane Protein & Active Protein & In Stock Protein

  • Relevance:

    Plays a major role in tight junction-specific obliteration of the intercellular space. (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells.

  • Endotoxin:

    Less than 1.0 EU/ug as determined by LAL method.

  • Purity:

    The purity information is not available for VLPs proteins.

  • Activity:

    Yes

  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 μg/mL can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU), the EC50 is 0.5574-0.7361 ng/mL.

  • Length:

    Full Length

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle miXIng. Avoid vigorous shaking or vorteXIng.

  • Molecular Weight:

    50.5 kDa

  • References & Citations:

    "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Gray A.M. Genome Res. 13:2265-2270 (2003) "Complete sequencing and characterization of 21, 243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S. Nat. Genet. 36:40-45 (2004)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.