Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A) (F176V), partial (Active)

• Product Name Alternative:

  CD16A

• Abbreviation:

  Recombinant Human FCGR3A protein (F176V), partial (Active)

• Gene Name:

  FCGR3A

• UniProt:

  P08637

• Expression Region:

  17-208aa (F176V)

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ

• Tag:

  C-terminal 10xHis-HSA-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Immunology

• Relevance:

  Receptor for the invariable Fc fragment of immunoglobulin gamma (IgG) . Optimally activated upon binding of clustered antigen-IgG complexes displayed on cell surfaces, triggers lysis of antibody-coated cells, a process known as antibody-dependent cellular cytotoxicity (ADCC) . Does not bind free monomeric IgG, thus avoiding inappropriate effector cell activation in the absence of antigenic trigger.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Loaded Anti-Human CD16a Antibody (CSB-RA008543MA1HU) on 96-Flat plate, can bind Human CD16a (F176V), with an affinity constant of 12 nM as determined in BLI assay (Gator Prime) .

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  90.6 kDa

• References & Citations:

  Alternative membrane forms of Fc gamma RIII (CD16) on human natural killer cells and neutrophils. Cell type-specific expression of two genes that differ in single nucleotide substitutions. Ravetch J.V., Perussia B. J. Exp. Med. 170:481-497 (1989)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial