Recombinant Human Fractalkine (CX3CL1), partial

CAT:
399-GTR13815980
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Fractalkine (CX3CL1), partial

  • Product Name Alternative:

    C-X3-C motif chemokine 1CX3C membrane-anchored chemokineNeurotactin; Small-inducible cytokine D1

  • Abbreviation:

    Recombinant Human CX3CL1 protein, partial

  • Gene Name:

    CX3CL1

  • UniProt:

    P78423

  • Expression Region:

    25-100aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG

  • Tag:

    N-terminal 6xHis-SUMO-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Cell Adhesion

  • Relevance:

    The soluble form is chotactic for T-cells and monocytes, but not for neutrophils. The mbrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Acts as a ligand for both CX3CR1 and integrins. Binds to CX3CR1

  • Molecular Weight:

    24.6 kDa

  • References & Citations:

    Structural basis of chemokine sequestration by CrmD, a poxvirus-encoded tumor necrosis factor receptor.Xue X., Lu Q., Wei H., Wang D., Chen D., He G., Huang L., Wang H., Wang X.PLoS Pathog. 7:E1002162-E1002162 (2011)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial