Recombinant Human Fractalkine (CX3CL1), partial

• Product Name Alternative:

  C-X3-C motif chemokine 1CX3C membrane-anchored chemokineNeurotactin; Small-inducible cytokine D1

• Abbreviation:

  Recombinant Human CX3CL1 protein, partial

• Gene Name:

  CX3CL1

• UniProt:

  P78423

• Expression Region:

  25-100aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG

• Tag:

  N-terminal 6xHis-SUMO-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Cell Adhesion

• Relevance:

  The soluble form is chotactic for T-cells and monocytes, but not for neutrophils. The mbrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Acts as a ligand for both CX3CR1 and integrins. Binds to CX3CR1

• Molecular Weight:

  24.6 kDa

• References & Citations:

  Structural basis of chemokine sequestration by CrmD, a poxvirus-encoded tumor necrosis factor receptor.Xue X., Lu Q., Wei H., Wang D., Chen D., He G., Huang L., Wang H., Wang X.PLoS Pathog. 7:E1002162-E1002162 (2011)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial