Recombinant Mouse Beta-defensin 6 (Defb6)

• Product Name Alternative:

  BD-6; mBD-6; Defensin, beta 6

• Abbreviation:

  Recombinant Mouse Defb6 protein

• Gene Name:

  Defb6

• UniProt:

  Q91VD6

• Expression Region:

  23-63aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  QLINSPVTCMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK

• Tag:

  N-terminal 6xHis-KSI-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Immunology

• Relevance:

  Has potent antibacterial activity against E.coli (ATCC 25922) .

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  19.8 kDa

• References & Citations:

  "A novel mouse beta-defensin, mBD-6, predominantly expressed in skeletal muscle." Yamaguchi Y., Fukuhara S., Nagase T., Tomita T., Hitomi S., Kimura S., Kurihara H., Ouchi Y. J. Biol. Chem. 276:31510-31514 (2001)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein