Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial (Active)

• Product Name Alternative:

  Cytokine receptor-like factor 2; Cytokine receptor-like 2; IL-XR; Thymic stromal lymphopoietin protein receptor (TSLP receptor) ; CRLF2; CRL2, ILXR, TSLPR

• Abbreviation:

  Recombinant Human CRLF2 protein, partial (Active)

• Gene Name:

  CRLF2

• UniProt:

  Q9HC73

• Expression Region:

  25-231aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK

• Tag:

  C-terminal hFc1-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Immunology

• Relevance:

  Receptor for thymic stromal lymphopoietin (TSLP) . Forms a functional complex with TSLP and IL7R which is capable of stimulating cell proliferation through activation of STAT3 and STAT5. Also activates JAK2) . Implicated in the development of the hematopoietic system.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 90% as determined by SDS-PAGE. Greater than 95% as determined by SEC-HPLC.

• Activity:

  Yes

• Bioactivity:

  Measured by its binding ability in a functional ELISA.Immobilized Human TSLP (CSB-MP025141HUh7) at 2 μg/mL can bind Human CRLF2 protein.The EC50 is 41.01-45.10 ng/mL.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  52.9 kDa

• References & Citations:

  Identification of amino acids in transmembrane domains of mutated cytokine receptor-like factor 2 and interleukin-7 receptor alpha required for constitutive signal transduction. Yamamoto R., Segawa R., Kato H., Niino Y., Sato T., Hiratsuka M., Hirasawa N. Biochim Biophys Acta Biomembr 1866:184359-184359 (2024)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial