Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial (Active)

CAT:
399-GTR13447546
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial (Active)

  • Product Name Alternative:

    Cytokine receptor-like factor 2; Cytokine receptor-like 2; IL-XR; Thymic stromal lymphopoietin protein receptor (TSLP receptor) ; CRLF2; CRL2, ILXR, TSLPR

  • Abbreviation:

    Recombinant Human CRLF2 protein, partial (Active)

  • Gene Name:

    CRLF2

  • UniProt:

    Q9HC73

  • Expression Region:

    25-231aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK

  • Tag:

    C-terminal hFc1-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Immunology

  • Relevance:

    Receptor for thymic stromal lymphopoietin (TSLP) . Forms a functional complex with TSLP and IL7R which is capable of stimulating cell proliferation through activation of STAT3 and STAT5. Also activates JAK2) . Implicated in the development of the hematopoietic system.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 90% as determined by SDS-PAGE. Greater than 95% as determined by SEC-HPLC.

  • Activity:

    Yes

  • Bioactivity:

    Measured by its binding ability in a functional ELISA.Immobilized Human TSLP (CSB-MP025141HUh7) at 2 μg/mL can bind Human CRLF2 protein.The EC50 is 41.01-45.10 ng/mL.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    52.9 kDa

  • References & Citations:

    Identification of amino acids in transmembrane domains of mutated cytokine receptor-like factor 2 and interleukin-7 receptor alpha required for constitutive signal transduction. Yamamoto R., Segawa R., Kato H., Niino Y., Sato T., Hiratsuka M., Hirasawa N. Biochim Biophys Acta Biomembr 1866:184359-184359 (2024)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial