Recombinant Human Tumor necrosis factor ligand superfamily member 13 (TNFSF13) (Active)

• Product Name Alternative:

  Tumor necrosis factor ligand superfamily member 13; A proliferation-inducing ligand (APRIL) ; TNF- and APOL-related leukocyte expressed ligand 2 (TALL-2) ; TNF-related death ligand 1 (TRDL-1) ; CD256; TNFSF13; APRIL, TALL2, ZTNF2; UNQ383/PRO715

• Abbreviation:

  Recombinant Human TNFSF13 protein (Active)

• Gene Name:

  TNFSF13

• UniProt:

  O75888-1

• Expression Region:

  105-250aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL

• Tag:

  N-terminal hFc-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Immunology

• Relevance:

  Cytokine that binds to TNFRSF13B/TACI and to TNFRSF17/BCMA. Plays a role in the regulation of tumor cell growth. May be involved in monocyte/macrophage-mediated immunological processes.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  ①Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF13 protein at 2 μg/mL can bind Human TNFRSF17 protein (CSB-MP023974HU1-B) . The EC50 is 0.8083-0.9391 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B protein (CSB-MP6427MOV) at 2 μg/mL can bind Human TNFSF13 protein. The EC50 is 11.13-18.97 ng/mL.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  42.6 kDa

• References & Citations:

  M2 macrophage-derived paracrine factor TNFSF13 affects the fibrogenic alterations in endothelial cells and cardiac fibroblasts by mediating the NF-kappaB and Akt pathway. Tan X., Wang J., Liu X., Xie G., Ouyang F. J Biochem Mol Toxicol 38:e23707-e23707 (2024)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein of Isoform Alpha