Recombinant Human Tumor necrosis factor ligand superfamily member 13 (TNFSF13) (Active)

CAT:
399-GTR13447827
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Tumor necrosis factor ligand superfamily member 13 (TNFSF13) (Active)

  • Product Name Alternative:

    Tumor necrosis factor ligand superfamily member 13; A proliferation-inducing ligand (APRIL) ; TNF- and APOL-related leukocyte expressed ligand 2 (TALL-2) ; TNF-related death ligand 1 (TRDL-1) ; CD256; TNFSF13; APRIL, TALL2, ZTNF2; UNQ383/PRO715

  • Abbreviation:

    Recombinant Human TNFSF13 protein (Active)

  • Gene Name:

    TNFSF13

  • UniProt:

    O75888-1

  • Expression Region:

    105-250aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL

  • Tag:

    N-terminal hFc-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Immunology

  • Relevance:

    Cytokine that binds to TNFRSF13B/TACI and to TNFRSF17/BCMA. Plays a role in the regulation of tumor cell growth. May be involved in monocyte/macrophage-mediated immunological processes.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    ①Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF13 protein at 2 μg/mL can bind Human TNFRSF17 protein (CSB-MP023974HU1-B) . The EC50 is 0.8083-0.9391 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B protein (CSB-MP6427MOV) at 2 μg/mL can bind Human TNFSF13 protein. The EC50 is 11.13-18.97 ng/mL.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    42.6 kDa

  • References & Citations:

    M2 macrophage-derived paracrine factor TNFSF13 affects the fibrogenic alterations in endothelial cells and cardiac fibroblasts by mediating the NF-kappaB and Akt pathway. Tan X., Wang J., Liu X., Xie G., Ouyang F. J Biochem Mol Toxicol 38:e23707-e23707 (2024)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein of Isoform Alpha