Recombinant Human Tumor necrosis factor receptor superfamily member 25 (TNFRSF25), partial (Active)

• Product Name Alternative:

  Tumor necrosis factor receptor superfamily member 25; Apo-3; Apoptosis-inducing receptor AIR; Apoptosis-mediating receptor DR3; Apoptosis-mediating receptor TRAMP; Death receptor 3; TNFRSF25; APO3, DDR3, DR3, TNFRSF12, WSL, WSL1; UNQ455/PRO779

• Abbreviation:

  Recombinant Human TNFRSF25 protein, partial (Active)

• Gene Name:

  TNFRSF25

• UniProt:

  Q93038

• Expression Region:

  25-199aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ

• Tag:

  C-terminal Twin-Strep-Avi-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Relevance:

  Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  ①Measured by its binding ability in a functional ELISA.Immobilized Human TNFRSF25 at 2 μg/mL can bind Anti-TNFRSF25 recombinant antibody (CSB-RA839000MA2HU) . The EC50 is 4.485-5.277 ng/mL. ②Measured by its binding ability in a functional ELISA.Immobilized Human TNFRSF25 at 2 μg/mL can bind Human TNFSF15 (CSB-MP023992HU1c9) . The EC50 is 13.26-15.80 ng/mL.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  25.8 kDa

• References & Citations:

  The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Gray A.M. Genome Res. 13:2265-2270 (2003)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial