Recombinant Human Tumor necrosis factor receptor superfamily member 25 (TNFRSF25), partial (Active)

CAT:
399-GTR13447014
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Tumor necrosis factor receptor superfamily member 25 (TNFRSF25), partial (Active)

  • Product Name Alternative:

    Tumor necrosis factor receptor superfamily member 25; Apo-3; Apoptosis-inducing receptor AIR; Apoptosis-mediating receptor DR3; Apoptosis-mediating receptor TRAMP; Death receptor 3; TNFRSF25; APO3, DDR3, DR3, TNFRSF12, WSL, WSL1; UNQ455/PRO779

  • Abbreviation:

    Recombinant Human TNFRSF25 protein, partial (Active)

  • Gene Name:

    TNFRSF25

  • UniProt:

    Q93038

  • Expression Region:

    25-199aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ

  • Tag:

    C-terminal Twin-Strep-Avi-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Cancer

  • Relevance:

    Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    ①Measured by its binding ability in a functional ELISA.Immobilized Human TNFRSF25 at 2 μg/mL can bind Anti-TNFRSF25 recombinant antibody (CSB-RA839000MA2HU) . The EC50 is 4.485-5.277 ng/mL. ②Measured by its binding ability in a functional ELISA.Immobilized Human TNFRSF25 at 2 μg/mL can bind Human TNFSF15 (CSB-MP023992HU1c9) . The EC50 is 13.26-15.80 ng/mL.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    25.8 kDa

  • References & Citations:

    The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Gray A.M. Genome Res. 13:2265-2270 (2003)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial