Recombinant Human Claudin-4 (CLDN4) -Detergent

• Product Name Alternative:

  Clostridium perfringens enterotoxin receptor; CPE-R; CPE-receptor; Williams-Beuren syndrome chromosomal region 8 protein

• Abbreviation:

  Recombinant Human CLDN4 protein-Detergent

• Gene Name:

  CLDN4

• UniProt:

  O14493

• Expression Region:

  1-209aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV

• Tag:

  N-terminal 10xHis-tagged and C-terminal Twin-Strep-tagged

• Type:

  MP-Detergent Transmembrane Protein & Developed Protein

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Relevance:

  Channel-forming tight junction protein that mediates paracellular chloride transport in the kidney. Plays a critical role in the paracellular reabsorption of filtered chloride in the kidney collecting ducts. Claudins play a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

• Endotoxin:

  Not test

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid

• Buffer:

  50 mM HEPES, 0.15 M NaCl, 0.05% DDM, 0.01% CHS, pH7.5

• Reconstitution:

  /

• Molecular Weight:

  26.6 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length