Recombinant Human Claudin-4 (CLDN4) -VLPs (Active)

• Product Name Alternative:

  (Clostridium perfringens enterotoxin receptor) (CPE-R) (CPE-receptor) (Williams-Beuren syndrome chromosomal region 8 protein)

• Abbreviation:

  Recombinant Human CLDN4 protein-VLPs (Active)

• Gene Name:

  CLDN4

• UniProt:

  O14493

• Expression Region:

  1-209aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV

• Tag:

  C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

• Type:

  MP-VLP Transmembrane Protein & Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Relevance:

  Channel-forming tight junction protein that mediates paracellular chloride transport in the kidney. Plays a critical role in the paracellular reabsorption of filtered chloride in the kidney collecting ducts. Claudins play a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  The purity information is not available for VLPs proteins.

• Activity:

  Yes

• Bioactivity:

  Measured by its binding ability in a functional ELISA. Immobilized Human CLDN4 at 5 μg/mL can bind Anti-CLDN4 recombinant antibody (CSB-RA005506MA1HU), the EC50 is 29.56-50.75 ng/mL.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

• Molecular Weight:

  23.4 kDa

• References & Citations:

  "Claudin association with CD81 defines hepatitis C virus entry." Harris H.J., Davis C., Mullins J.G., Hu K., Goodall M., Farquhar M.J., Mee C.J., McCaffrey K., Young S., Drummer H., Balfe P., McKeating J.A. J. Biol. Chem. 285:21092-21102 (2010)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length