Recombinant Brugia malayi tRNA (guanine-N (7) -) -methyltransferase (Bm1_01445)

CAT:
399-GTR04835302
Size:
20 µg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Brugia malayi tRNA (guanine-N (7) -) -methyltransferase (Bm1_01445)

  • Product Name Alternative:

    TRNA (guanine (46) -N (7) ) -methyltransferase tRNA (m7G46) -methyltransferase

  • Abbreviation:

    Recombinant Brugia malayi Bm1_01445 protein

  • Gene Name:

    Bm1_01445

  • UniProt:

    A8NFF0

  • Expression Region:

    1-258aa

  • Organism:

    Brugia malayi (Filarial nematode worm)

  • Target Sequence:

    MVSTENKIGLFKNKDDDIDGEEMRELPQKKFYRQRAHANPISDHEFDYPVFPEQMDWKKYFGDFSEGRQVEFADVGCGYGGLLIKLSTLYPEALMVGLEIRVKVSDYVQDKIHALRLREPGNYRNVACLRTNAMKYLPNYFRRHQLTKMFFLYPDPHFKKAKHKWRIITPTLLAEYAYVLKPGGLVYTITDVEELHIWMVRHLSAHPLFERLTDLEMKMDPVVEMLYDSTEEGQKVARNEGSKWSAVFRRLPNPVLSS

  • Tag:

    N-terminal 10xHis-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Relevance:

    Catalyzes the formation of N7-methylguanine at position 46 (m7G46) in tRNA.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    36.3 kDa

  • References & Citations:

    "Draft genome of the filarial nematode parasite Brugia malayi." Ghedin E., Wang S., Spiro D., Caler E., Zhao Q., Crabtree J., Allen J.E., Delcher A.L., Guiliano D.B., Miranda-Saavedra D., Angiuoli S.V., Creasy T., Amedeo P., Haas B., El-Sayed N.M., Wortman J.R., Feldblyum T., Tallon L. Scott A.L. Science 317:1756-1760 (2007)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length