Recombinant Brugia malayi tRNA (guanine-N (7) -) -methyltransferase (Bm1_01445)

• Product Name Alternative:

  TRNA (guanine (46) -N (7) ) -methyltransferase tRNA (m7G46) -methyltransferase

• Abbreviation:

  Recombinant Brugia malayi Bm1_01445 protein

• Gene Name:

  Bm1_01445

• UniProt:

  A8NFF0

• Expression Region:

  1-258aa

• Organism:

  Brugia malayi (Filarial nematode worm)

• Target Sequence:

  MVSTENKIGLFKNKDDDIDGEEMRELPQKKFYRQRAHANPISDHEFDYPVFPEQMDWKKYFGDFSEGRQVEFADVGCGYGGLLIKLSTLYPEALMVGLEIRVKVSDYVQDKIHALRLREPGNYRNVACLRTNAMKYLPNYFRRHQLTKMFFLYPDPHFKKAKHKWRIITPTLLAEYAYVLKPGGLVYTITDVEELHIWMVRHLSAHPLFERLTDLEMKMDPVVEMLYDSTEEGQKVARNEGSKWSAVFRRLPNPVLSS

• Tag:

  N-terminal 10xHis-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Catalyzes the formation of N7-methylguanine at position 46 (m7G46) in tRNA.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  36.3 kDa

• References & Citations:

  "Draft genome of the filarial nematode parasite Brugia malayi." Ghedin E., Wang S., Spiro D., Caler E., Zhao Q., Crabtree J., Allen J.E., Delcher A.L., Guiliano D.B., Miranda-Saavedra D., Angiuoli S.V., Creasy T., Amedeo P., Haas B., El-Sayed N.M., Wortman J.R., Feldblyum T., Tallon L. Scott A.L. Science 317:1756-1760 (2007)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length