Recombinant Drosophila melanogaster Protein-L-isoaspartate (D-aspartate) O-methyltransferase (Pcmt)

• Product Name Alternative:

  L-isoaspartyl protein carboxyl methyltransferase Protein L-isoaspartyl/D-aspartyl methyltransferase Protein-beta-aspartate methyltransferase dPIMT

• Abbreviation:

  Recombinant Drosophila melanogaster Pcmt protein

• Gene Name:

  Pcmt

• UniProt:

  Q27869

• Expression Region:

  1-226aa

• Organism:

  Drosophila melanogaster (Fruit fly)

• Target Sequence:

  MAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTISAPHMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQYMQQYDKDANGKVEMTRLMGVMYVPLTDLRS

• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Biochemicals

• Relevance:

  Catalyzes the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  32.0 kDa

• References & Citations:

  "Structural organization and developmental expression of the protein isoaspartyl methyltransferase gene from Drosophila melanogaster." O'Connor M.B., Galus A., Hartenstine M., Magee M., Jackson F.R., O'Connor C.M. Insect Biochem. Mol. Biol. 27:49-54 (1997)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length