Recombinant Drosophila melanogaster Profilin (chic)

CAT:
399-GTR04829199
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Drosophila melanogaster Profilin (chic)

  • Product Name Alternative:

    Protein chickadee

  • Abbreviation:

    Recombinant Drosophila melanogaster chic protein

  • Gene Name:

    Chic

  • UniProt:

    P25843

  • Expression Region:

    1-126aa

  • Organism:

    Drosophila melanogaster (Fruit fly)

  • Target Sequence:

    MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSSGFEVTKEELSKLISGFDQQDGLTSNGVTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDYLITCGY

  • Tag:

    C-terminal 10xHis-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Relevance:

    Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it may inhibit the formation of IP3 and DG. This profilin is required for intercellular cytoplasm transport during Drosophila oogenesis . Function in neurons is essential for adult survival, and is important for climbing behavior and activity.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Bioactivity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    23.5 kDa

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length