Recombinant Epstein-Barr virus Trans-activator protein BZLF1 (BZLF1)

• Product Name Alternative:

  Zebra

• Abbreviation:

  Recombinant Epstein-Barr virus BZLF1 protein

• Gene Name:

  BZLF1

• UniProt:

  Q3KSS8

• Expression Region:

  1-245aa

• Organism:

  Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)

• Target Sequence:

  MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQLTAYHVSAAPTGSWFPAPQPAPENAYQAYAAPQLFPVSDITQNQLTNQAGGEAPQPGDNSTVQPAAAVVLACPGANQEQQLADIGAPQPAPAAAPARRTRKPLQPESLEECDSELEIKRYKNRVASRKCRAKFKHLLQHYREVASAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHEDLLNF

• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Plays a key role in the switch from latent infection to lytic cycle producing new virions. Acts as a transcription factor, inducing early lytic cycle genes, and as a origin binding protein for genome replication. BZLF1 activates the promoter of another EBV gene (BSLF2+BMLF1)

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Plays a key role in the switch from latent infection to lytic cycle producing new virions. Acts as a transcription factor, inducing early lytic cycle genes, and as a origin binding protein for genome replication. BZLF1 activates the promoter of another EBV gene (BSLF2+BMLF1) (By similarity) .

• Molecular Weight:

  33.8 kDa

• References & Citations:

  "New BZLF1 sequence variations in EBV-associated undifferentiated nasopharyngeal carcinoma in southern China." Ji K.-M., Li C.-L., Meng G., Han A.-D., Wu X.-L. Arch. Virol. 153:1949-1953 (2008)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length