Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 3 (EBNA3), partial

• Product Name Alternative:

  (EBNA-3) (EBV nuclear antigen 3) (Epstein-Barr nuclear antigen 3A) (EBNA-3A) (EBV nuclear antigen 3A)

• Abbreviation:

  Recombinant Epstein-Barr virus EBNA3 protein, partial

• Gene Name:

  EBNA3

• UniProt:

  Q3KST2

• Expression Region:

  1-138aa

• Organism:

  Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)

• Target Sequence:

  MDKDRPGDPALDDNMEEEVPSTSVVQEQVSAGDWENVLIELSDSSSEKEAEDAQLEPAQKGTKRKRVDHDAGGSAPARPMLPPQPDLPGREAILRRFPLDLRTLLQAIGAAATRIDTRAIDQFFGSQISNTEMYIMYA

• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Plays an essential role for activation and immortalization of human B-cells. Represses transcription of viral promoters TP1 and Cp through interaction with host RBPJ, and inhibits EBNA2-mediated activation of these promoters. Since Cp is the promoter for all EBNA mRNAs, EBNA3A probably contributes to a negative autoregulatory control loop.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  22.6 kDa

• References & Citations:

  "A structural basis for varied alphabeta TCR usage against an immunodominant EBV antigen restricted to a HLA-B8 molecule." Gras S., Wilmann P.G., Chen Z., Halim H., Liu Y.C., Kjer-Nielsen L., Purcell A.W., Burrows S.R., McCluskey J., Rossjohn J. J Immunol 188:311-321 (2012) .

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial