Recombinant Human T-cell surface glycoprotein CD1c (CD1C), partial

CAT:
399-GTR04838622
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human T-cell surface glycoprotein CD1c (CD1C), partial

  • Product Name Alternative:

    BDCA1; CD1; CD1A; CD1c; CD1c antigen; CD1C antigen c polypeptide; CD1c molecule; CD1C_HUMAN; Cortical thymocyte antigen CD1C; Differentiation antigen CD1 alpha 3; R7; T cell surface glycoprotein CD1c; T-cell surface glycoprotein CD1c

  • Abbreviation:

    Recombinant Human CD1C protein, partial

  • Gene Name:

    CD1C

  • UniProt:

    P29017

  • Expression Region:

    18-302aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHFSM

  • Tag:

    N-terminal 6xHis-tagged

  • Type:

    Developed Protein

  • Source:

    Yeast

  • Field of Research:

    Immunology

  • Relevance:

    Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.

  • Molecular Weight:

    34.2 kDa

  • References & Citations:

    "Human CD1b and CD1c isoforms survey different intracellular compartments for the presentation of microbial lipid antigens."Briken V., Jackman R.M., Watts G.F.M., Rogers R.A., Porcelli S.A.J. Exp. Med. 192:281-288 (2000) .

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Extracellular Domain