Recombinant Human T-cell surface glycoprotein CD1c (CD1C), partial

• Product Name Alternative:

  BDCA1; CD1; CD1A; CD1c; CD1c antigen; CD1C antigen c polypeptide; CD1c molecule; CD1C_HUMAN; Cortical thymocyte antigen CD1C; Differentiation antigen CD1 alpha 3; R7; T cell surface glycoprotein CD1c; T-cell surface glycoprotein CD1c

• Abbreviation:

  Recombinant Human CD1C protein, partial

• Gene Name:

  CD1C

• UniProt:

  P29017

• Expression Region:

  18-302aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHFSM

• Tag:

  N-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  Yeast

• Field of Research:

  Immunology

• Relevance:

  Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.

• Molecular Weight:

  34.2 kDa

• References & Citations:

  "Human CD1b and CD1c isoforms survey different intracellular compartments for the presentation of microbial lipid antigens."Briken V., Jackman R.M., Watts G.F.M., Rogers R.A., Porcelli S.A.J. Exp. Med. 192:281-288 (2000) .

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Extracellular Domain