Recombinant Human Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1)

• Product Name Alternative:

  1700007B22Rik; AI850911; Fank1; FANK1_HUMAN; Fibronectin type 3 and ankyrin repeat domains 1; Fibronectin type 3 and ankyrin repeat domains protein 1; Fibronectin type III and ankyrin repeat domains 1; HSD13

• Abbreviation:

  Recombinant Human FANK1 protein

• Gene Name:

  FANK1

• UniProt:

  Q8TC84

• Expression Region:

  1-345aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  MEPQKIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSVNDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVC

• Tag:

  N-terminal 6xHis-SUMO-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Developmental Biology

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Through the activation of JUN and AP-1-mediated transcription, may regulate apoptosis.

• Molecular Weight:

  54.3 kDa

• References & Citations:

  A new spermatogenesis-related gene.Hu T.H., Miao S.Y., Zhang X.D., Qiao Y., Liang G., Wang L.F. Fank1 is a testis-specific gene encoding a nuclear protein exclusively expressed during the transition from the meiotic to the haploid phase of spermatogenesis.Zheng Z., Zheng H., Yan W.Gene Expr. Patterns 7:777-783 (2007)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length