Recombinant Human Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1)

CAT:
399-GTR04829402
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1)

  • Product Name Alternative:

    1700007B22Rik; AI850911; Fank1; FANK1_HUMAN; Fibronectin type 3 and ankyrin repeat domains 1; Fibronectin type 3 and ankyrin repeat domains protein 1; Fibronectin type III and ankyrin repeat domains 1; HSD13

  • Abbreviation:

    Recombinant Human FANK1 protein

  • Gene Name:

    FANK1

  • UniProt:

    Q8TC84

  • Expression Region:

    1-345aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    MEPQKIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSVNDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVC

  • Tag:

    N-terminal 6xHis-SUMO-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Developmental Biology

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Through the activation of JUN and AP-1-mediated transcription, may regulate apoptosis.

  • Molecular Weight:

    54.3 kDa

  • References & Citations:

    A new spermatogenesis-related gene.Hu T.H., Miao S.Y., Zhang X.D., Qiao Y., Liang G., Wang L.F. Fank1 is a testis-specific gene encoding a nuclear protein exclusively expressed during the transition from the meiotic to the haploid phase of spermatogenesis.Zheng Z., Zheng H., Yan W.Gene Expr. Patterns 7:777-783 (2007)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length