Recombinant Human Thioredoxin domain-containing protein 12 (TXNDC12)

CAT:
399-GTR04827194
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Thioredoxin domain-containing protein 12 (TXNDC12)

  • Product Name Alternative:

    Endoplasmic reticulum resident protein 18 ; ER protein 18 ; ERp18Endoplasmic reticulum resident protein 19 ; ER protein 19 ; ERp19Thioredoxin-like protein p19hTLP19

  • Abbreviation:

    Recombinant Human TXNDC12 protein

  • Gene Name:

    TXNDC12

  • UniProt:

    O95881

  • Expression Region:

    27-172aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL

  • Tag:

    N-terminal 6xHis-SUMO-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Signal Transduction

  • Relevance:

    Possesses significant protein thiol-disulfide oxidase activity.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Possesses significant protein thiol-disulfide oxidase activity.

  • Molecular Weight:

    32.4 kDa

  • References & Citations:

    Solution structure and dynamics of ERp18, a small endoplasmic reticulum resident oxidoreductase.Rowe M.L., Ruddock L.W., Kelly G., Schmidt J.M., Williamson R.A., Howard M.J.Biochemistry 48:4596-4606 (2009)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein