Recombinant Human Thioredoxin-like protein 4B (TXNL4B)

• Product Name Alternative:

  Dim1-like protein

• Abbreviation:

  Recombinant Human TXNL4B protein

• Gene Name:

  TXNL4B

• UniProt:

  Q9NX01

• Expression Region:

  1-149aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

• Tag:

  N-terminal GST-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Epigenetics and Nuclear Signaling

• Relevance:

  Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G2 transition.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G (2) transition.

• Molecular Weight:

  44 kDa

• References & Citations:

  "DLP, a novel Dim1 family protein implicated in pre-mRNA splicing and cell cycle progression." Sun X., Zhang H., Wang D., Ma D., Shen Y., Shang Y. J. Biol. Chem. 279:32839-32847 (2004)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length