Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial (Active)

• Product Name Alternative:

  Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R; Glp1r

• Abbreviation:

  Recombinant Mouse Glp1r protein, partial (Active)

• Gene Name:

  Glp1r

• UniProt:

  O35659

• Expression Region:

  22-145aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY

• Tag:

  C-terminal 10xHis-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Neuroscience

• Relevance:

  G-protein coupled receptor for glucagon-like peptide 1 (GLP-1) . Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1. Selective recognition of glucagon-like peptide over glucagon is determined by residues located at the C-terminal end of the glucagon-like peptide.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Measured by its binding ability in a functional ELISA. Immobilized Mouse Glp1r at 2 μg/mL can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA3HU) . The EC50 is 141.7-172.4 ng/mL.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  15.8 kDa

• References & Citations:

  A vagal reflex evoked by airway closure. Schappe M.S., Brinn P.A., Joshi N.R., Greenberg R.S., Min S., Alabi A.A., Zhang C., Liberles S.D. Nature 627:830-838 (2024)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial