Recombinant Rat Chemerin-like receptor 2 (Cmklr2)

CAT:
399-GTR04768418
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Rat Chemerin-like receptor 2 (Cmklr2)

  • Product Name Alternative:

    (Chemerin chemokine-like receptor 2) (Chemokine-like receptor 2) (G-protein coupled receptor 1)

  • Abbreviation:

    Recombinant Rat Cmklr2 protein

  • Gene Name:

    Cmklr2

  • UniProt:

    P46090

  • Expression Region:

    1-353aa

  • Organism:

    Rattus norvegicus (Rat)

  • Target Sequence:

    MEVSREMLFEELDNYSYALEYYSQEPDAEENVYPGIVHWISLLLYALAFVLGIPGNAIVIWFMGFKWKKTVTTLWFLNLAIADFVFVLFLPLYISYVALSFHWPFGRWLCKLNSFIAQLNMFSSVFFLTVISLDRYIHLIHPGLSHPHRTLKNSLLVVLFVWLLASLLGGPTLYFRDTVEVNNRIICYNNFQEYELTLMRHHVLTWVKFLFGYLLPLLTMSSCYLCLIFKTKKQNILISSKHLWMILSVVIAFMVCWTPFHLFSIWELSIHHNSSFQNVLQGGIPLSTGLAFLNSCLNPILYVLISKKFQARFRASVAEVLKRSLWEASCSGTVSEQLRSAETKSLSLLETAQ

  • Tag:

    N-terminal 10xHis-tagged

  • Type:

    CF Transmembrane Protein & In Stock Protein

  • Source:

    In vitro E.coli expression system

  • Field of Research:

    Cell Biology

  • Relevance:

    Receptor for chemoattractant adipokine chemerin/RARRES2 suggesting a role for this receptor in the regulation of inflammation and energy homesotasis . Signals mainly via beta-arrestin pathway. Binding of RARRES2 activates weakly G proteins, calcium mobilization and MAPK1/MAPK3 (ERK1/2) phosphorylation too. Acts also as a receptor for TAFA1, mediates its effects on neuronal stem-cell proliferation and differentiation via the activation of ROCK/ERK and ROCK/STAT3 signaling pathway .

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    42.4 kDa

  • References & Citations:

    "Mapping studies of two G protein-coupled receptor genes: an amino acid difference may confer a functional variation between a human and rodent receptor." Marchese A., Cheng R., Lee M.C., Porter C.A., Heiber M., Goodman M., George S.R., O'Dowd B.F. Biochem. Biophys. Res. Commun. 205:1952-1958 (1994)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length