Recombinant Human rhinovirus A serotype 89 Genome polyprotein, partial, Biotinylated

• Product Name Alternative:

  3D polymerase Protein 3D

• Abbreviation:

  Recombinant Human rhinovirus A serotype 89 Genome polyprotein, partial, Biotinylated

• UniProt:

  P07210

• Expression Region:

  575-866aa

• Organism:

  Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89)

• Target Sequence:

  NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV

• Tag:

  N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Microbiology

• Relevance:

  Capsid protein VP1: Forms an icosahedral capsid of pseudo T=3 symmetry with capsid proteins VP2 and VP3 (By similarity) . The capsid is 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome (By similarity) . Capsid protein VP1 mainly forms the vertices of the capsid (By similarity) . Capsid protein VP1 interacts with host cell receptor to provide virion attachment to target host cells (By similarity) . This attachment induces virion internalization (By similarity) . Tyrosine kinases are probably involved in the entry process (By similarity) . After binding to its receptor, the capsid undergoes conformational changes (By similarity) . Capsid protein VP1 N-terminus (that contains an amphipathic alpha-helix) and capsid protein VP4 are externalized (By similarity) . Together, they shape a pore in the host membrane through which viral genome is translocated to host cell cytoplasm (By similarity) .

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  80.4 kDa

• References & Citations:

  "Evolutionary relationships within the human rhinovirus genus: comparison of serotypes 89, 2, and 14." Duechler M., Skern T., Sommergruber W., Neubauer C., Gruendler P., Fogy I., Blaas D., Kuechler E. Proc. Natl. Acad. Sci. U.S.A. 84:2605-2609 (1987)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial