Recombinant Human Vascular endothelial growth factor B (VEGFB), partial

CAT:
399-GTR04836624
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Vascular endothelial growth factor B (VEGFB), partial

  • Product Name Alternative:

    VEGF-related factor ; VRF

  • Abbreviation:

    Recombinant Human VEGFB protein, partial

  • Gene Name:

    VEGFB

  • UniProt:

    P49765

  • Expression Region:

    31-129aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    HQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKK

  • Tag:

    N-terminal 6xHis-SUMO-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Cancer

  • Relevance:

    Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    24.1 kDa

  • References & Citations:

    Cloning and characterization of a novel human gene related to vascular endothelial growth factor.Grimmond S., Lagercrantz J., Drinkwater C., Silins G., Townson S., Pollock P., Gotley D., Carson E., Rakar S., Nordenskjoeld M., Ward L., Hayward N.K., Weber G.Genome Res. 6:124-131 (1996)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial