Recombinant Arabidopsis thaliana Glucan endo-1,3-beta-glucosidase 10

• Product Name Alternative:

  ((1->3) -beta-glucan endohydrolase 10) ((1->3) -beta-glucanase 10) (Beta-1,3-endoglucanase 10) (Beta-1,3-glucanase 10) (Putative plasmodesmal associated protein) (AtBG_ppap)

• Abbreviation:

  Recombinant Mouse-ear cress Glucan endo-1,3-beta-glucosidase 10 protein

• UniProt:

  Q9FHX5

• Expression Region:

  27-425aa

• Organism:

  Arabidopsis thaliana (Mouse-ear cress)

• Target Sequence:

  IGINYGQVANNLPPPKNVIPLLKSVGATKVKLYDADPQALRAFAGSGFELTVALGNEYLAQMSDPIKAQGWVKENVQAYLPNTKIVAIVVGNEVLTSNQSALTAALFPAMQSIHGALVDCGLNKQIFVTTAHSLAILDVSYPPSATSFRRDLLGSLTPILDFHVKTGSPILINAYPFFAYEENPKHVSLDFVLFQPNQGFTDPGSNFHYDNMLFAQVDAVYHALDAVGISYKKVPIVVSETGWPSNGDPQEVGATCDNARKYNGNLIKMMMSKKMRTPIRPECDLTIFVFALFNENMKPGPTSERNYGLFNPDGTPVYSLGIKTSSTHSSGSGSSNSTGGSSSGGGGNTGGSSSGGGIYQPVTGNPSPDYMSISSAGGKGRFVECVLFFFLLCIIKLRLKLLQPGR

• Tag:

  N-terminal 6xHis-EGFP-tagged

• Type:

  Developed Protein

• Source:

  Baculovirus

• Field of Research:

  Others

• Relevance:

  Plasmodesmal-associated membrane beta-1,3-glucanase involved in plasmodesmal callose degradation and functions in the gating of plasmodesmata.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  71.5 kDa

• References & Citations:

  "Subcellular dynamics and role of Arabidopsis beta-1,3-glucanases in cell-to-cell movement of tobamoviruses." Zavaliev R., Levy A., Gera A., Epel B.L. Mol. Plant Microbe Interact. 26:1016-1030 (2013)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein