Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein (32)

CAT:
399-GTR04833552
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein (32)

  • Product Name Alternative:

    (SSB protein) (Gp32) (Helix-destabilizing protein)

  • Abbreviation:

    Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein

  • Gene Name:

    32

  • UniProt:

    P03695

  • Expression Region:

    1-301aa

  • Organism:

    Enterobacteria phage T4 (Bacteriophage T4)

  • Target Sequence:

    MFKRKSTAELAAQMAKLNGNKGFSSEDKGEWKLKLDNAGNGQAVIRFLPSKNDEQAPFAILVNHGFKKNGKWYIETCSSTHGDYDSCPVCQYISKNDLYNTDNKEYSLVKRKTSYWANILVVKDPAAPENEGKVFKYRFGKKIWDKINAMIAVDVEMGETPVDVTCPWEGANFVLKVKQVSGFSNYDESKFLNQSAIPNIDDESFQKELFEQMVDLSEMTSKDKFKSFEELNTKFGQVMGTAVMGGAAATAAKKADKVADDLDAFNVDDFNTKTEDDFMSSSSGSSSSADDTDLDDLLNDL

  • Tag:

    C-terminal 6xHis-tagged

  • Type:

    Developed Protein

  • Source:

    Yeast

  • Field of Research:

    Others

  • Relevance:

    Single-stranded DNA-binding protein that participates in viral DNA replication, recombination, and repair (Probable) . Coats the lagging-strand ssDNA as the replication fork advances . Stimulates the activities of viral DNA polymerase and DnaB-like SF4 replicative helicase, probably via its interaction with the helicase assembly factor . Together with DnaB-like SF4 replicative helicase and the helicase assembly factor, promotes pairing of two homologous DNA molecules containing complementary single-stranded regions and mediates homologous DNA strand exchange . Promotes also the formation of joint molecules . mRNA specific autogenous translational repressor .

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    35.0 kDa

  • References & Citations:

    "Crystal structure of a replication fork single-stranded DNA binding protein (T4 gp32) complexed to DNA." Shamoo Y., Friedman A.M., Parsons M.R., Konigsberg W.H., Steitz T.A. Nature 376:362-366 (1995)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length