Recombinant Mouse Tumor necrosis factor ligand superfamily member 15 (Tnfsf15), partial (Active)

• Product Name Alternative:

  TNF ligand-related molecule 1; Vascular endothelial cell growth inhibitor Gene names

• Abbreviation:

  Recombinant Mouse Tnfsf15 protein, partial (Active)

• Gene Name:

  Tnfsf15

• UniProt:

  Q5UBV8

• Expression Region:

  61-252aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  AGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL

• Tag:

  N-terminal 10xHis-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Relevance:

  Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro) . Promotes activation of caspases and apoptosis.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Measured by its binding ability in a functional ELISA. Immobilized Mouse Tnfsf15 at 2 μg/mL can bind Anti-TNFSF15 recombinant antibody (CSB-RA023992MA1HU) . The EC50 is 1.671-2.506 ng/mL.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  24.3 kDa

• References & Citations:

  TL1A is a TNF-like ligand for DR3 and TR6/DcR3 and functions as a T cell costimulator. Migone T.-S., Zhang J., Luo X., Zhuang L., Chen C., Hu B., Hong J.S., Perry J.W., Chen S.-F., Wei P. Immunity 16:479-492 (2002)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial