Recombinant Mouse Amelotin (Amtn)

CAT:
399-GTR04830541
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Mouse Amelotin (Amtn)

  • Abbreviation:

    Recombinant Mouse Amtn protein

  • Gene Name:

    Amtn

  • UniProt:

    Q9D3J8

  • Expression Region:

    17-213aa

  • Organism:

    Mus musculus (Mouse)

  • Target Sequence:

    LPKQLNPASGVPATKPTPGQVTPLPQQQPNQVFPSISLIPLTQLLTLGSDLPLFNPAAGPHGAHTLPFTLGPLNGQQQLQPQMLPIIVAQLGAQGALLSSEELPLASQIFTGLLIHPLFPGAIPPSGQAGTKPDVQNGVLPTRQAGAKAVNQGTTPGHVTTPGVTDDDDYEMSTPAGLRRATHTTEGTTIDPPNRTQ

  • Tag:

    N-terminal 10xHis-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Relevance:

    Is a promoter of calcium phosphate mineralization, playing a critical role in the formation of the compact, mineralized, aprismatic enamel surface layer during the maturation stage of amelogenesis.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    26.5 kDa

  • References & Citations:

    "Cloning of rat amelotin and localization of the protein to the basal lamina of maturation stage ameloblasts and junctional epithelium." Moffatt P., Smith C.E., St Arnaud R., Simmons D., Wright J.T., Nanci A. Biochem. J. 399:37-46 (2006)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein