Recombinant Human Interleukin-6 (IL6) (Active)

• Product Name Alternative:

  Interleukin-6; IL-6; B-cell stimulatory factor 2 (BSF-2) ; CTL differentiation factor (CDF) ; Hybridoma growth factor; Interferon beta-2 (IFN-beta-2) ; IL6 ; IFNB2

• Abbreviation:

  Recombinant Human IL6 protein (Active)

• Gene Name:

  IL6

• UniProt:

  P05231

• Expression Region:

  30-212aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

• Tag:

  N-terminal 6xHis-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Yeast

• Field of Research:

  Cancer

• Relevance:

  Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 58 - 295 pg/mL.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  22.8 kDa

• References & Citations:

  "Complementary DNA for a novel human interleukin (BSF-2) that induces B lymphocytes to produce immunoglobulin." Hirano T., Yasukawa K., Harada H., Taga T., Watanabe Y., Matsuda T., Kashiwamura S., Nakajima K., Koyama K., Kishimoto T. Nature 324:73-76 (1986) "Structure and expression of human B cell stimulatory factor-2 (BSF-2/IL-6) gene." Yasukawa K., Hirano T., Watanabe Y., Muratani K., Matsuda T., Nakai S., Kishimoto T. EMBO J. 6:2939-2945 (1987)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein